Lineage for d3obvb_ (3obv B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006858Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 protein domains)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
  6. 2006859Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 2006860Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 2006864Domain d3obvb_: 3obv B: [233063]
    automated match to d3obva_
    complexed with suc

Details for d3obvb_

PDB Entry: 3obv (more details), 2.75 Å

PDB Description: autoinhibited formin mdia1 structure
PDB Compounds: (B:) Protein diaphanous homolog 1

SCOPe Domain Sequences for d3obvb_:

Sequence, based on SEQRES records: (download)

>d3obvb_ a.118.1.23 (B:) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
ssrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhd
ekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaa
kllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlina
litpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrl
ddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsq
ivlhkngtdpdfkcrhlqidierlvd

Sequence, based on observed residues (ATOM records): (download)

>d3obvb_ a.118.1.23 (B:) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
ssrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhd
eydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalc
ilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaee
ldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmem
ddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlhkng
tdpdfkcrhlqidierlvd

SCOPe Domain Coordinates for d3obvb_:

Click to download the PDB-style file with coordinates for d3obvb_.
(The format of our PDB-style files is described here.)

Timeline for d3obvb_: