Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
Protein automated matches [191122] (10 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [233056] (1 PDB entry) |
Domain d3o0mb_: 3o0m B: [233058] Other proteins in same PDB: d3o0ma2 automated match to d2eo4a_ complexed with act, amp, mpd, zn |
PDB Entry: 3o0m (more details), 1.9 Å
SCOPe Domain Sequences for d3o0mb_:
Sequence, based on SEQRES records: (download)
>d3o0mb_ d.13.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} scvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppetvagma avgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfakgmvmrr dpdreesgrllraalaqldsa
>d3o0mb_ d.13.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} scvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppetvagma avgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfrrdpdree sgrllraalaqldsa
Timeline for d3o0mb_: