Lineage for d3o0mb_ (3o0m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930037Species Mycobacterium smegmatis [TaxId:246196] [233056] (1 PDB entry)
  8. 2930039Domain d3o0mb_: 3o0m B: [233058]
    Other proteins in same PDB: d3o0ma2
    automated match to d2eo4a_
    complexed with act, amp, mpd, zn

Details for d3o0mb_

PDB Entry: 3o0m (more details), 1.9 Å

PDB Description: crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis
PDB Compounds: (B:) HIT family protein

SCOPe Domain Sequences for d3o0mb_:

Sequence, based on SEQRES records: (download)

>d3o0mb_ d.13.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
scvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppetvagma
avgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfakgmvmrr
dpdreesgrllraalaqldsa

Sequence, based on observed residues (ATOM records): (download)

>d3o0mb_ d.13.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
scvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppetvagma
avgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfrrdpdree
sgrllraalaqldsa

SCOPe Domain Coordinates for d3o0mb_:

Click to download the PDB-style file with coordinates for d3o0mb_.
(The format of our PDB-style files is described here.)

Timeline for d3o0mb_: