Lineage for d3nx3b_ (3nx3 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896870Species Campylobacter jejuni [TaxId:192222] [196590] (3 PDB entries)
  8. 2896872Domain d3nx3b_: 3nx3 B: [233055]
    automated match to d3nx3a_
    complexed with mg

Details for d3nx3b_

PDB Entry: 3nx3 (more details), 1.8 Å

PDB Description: Crystal structure of acetylornithine aminotransferase (argD) from Campylobacter jejuni
PDB Compounds: (B:) Acetylornithine aminotransferase

SCOPe Domain Sequences for d3nx3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nx3b_ c.67.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
krfdivlekgqgvylfddkakkyldfssgigvcalgynhakfnakikaqvdkllhtsnly
yneniaaaaknlakasalervfftnsgtesiegamktarkyafnkgvkggqfiafkhsfh
grtlgalsltanekyqkpfkplisgvkfakyndissveklvnektcaiilesvqgeggin
pankdfykalrklcdekdilliadeiqcgmgrsgkffayehaqilpdimtsakalgcgls
vgafvinqkvasnsleagdhgstyggnplvcagvnavfeifkeekilenvnkltpyleqs
ldelinefdfckkrkglgfmqglsldksvkvakviqkcqenallliscgendlrflppli
lqkehidemseklrkalksf

SCOPe Domain Coordinates for d3nx3b_:

Click to download the PDB-style file with coordinates for d3nx3b_.
(The format of our PDB-style files is described here.)

Timeline for d3nx3b_: