SCOPe 2.06: Domain d3nvvb2: 3nvv B:415-528

Lineage for d3nvvb2 (3nvv B:415-528)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)

8. Domain d3nvvb2: 3nvv B:415-528 [233054]
   Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb1, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk1, d3nvvl1, d3nvvl2
   automated match to d1fo4a4
   complexed with ast, fad, fes, mos, mte

Details for d3nvvb2

PDB Entry: 3nvv, 1.82 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite

PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvvb2:

Sequence; same for both SEQRES and ATOM records:

>d3nvvb2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3nvvb2:

• d3nvvb2 first appeared in SCOPe 2.03
  
• d3nvvb2 appears in SCOPe 2.05
  
• d3nvvb2 appears in SCOPe 2.07
  
• d3nvvb2 appears in the current release, SCOPe 2.08