Lineage for d3nuia1 (3nui A:30-453)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2133006Species Vibrio fluvialis [TaxId:676] [233050] (3 PDB entries)
  8. 2133015Domain d3nuia1: 3nui A:30-453 [233052]
    Other proteins in same PDB: d3nuia2, d3nuib2
    automated match to d3n5ma_

Details for d3nuia1

PDB Entry: 3nui (more details), 2 Å

PDB Description: Crystal structure of omega-transferase from Vibrio Fluvialis JS17
PDB Compounds: (A:) Pyruvate transaminase

SCOPe Domain Sequences for d3nuia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nuia1 c.67.1.0 (A:30-453) automated matches {Vibrio fluvialis [TaxId: 676]}
tvvvthgegpyivdvngrryldansglwnmvagfdhkglidaakaqyerfpgyhaffgrm
sdqtvmlseklvevspfdsgrvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwna
yhgvtavsasmtgkpynsvfglplpgfvhltcphywrygeegeteeqfvarlareleeti
qregadtiagffaepvmgaggvippakgyfqailpilrkydipvisdevicgfgrtgntw
gcvtydftpdaiissknltagffpmgavilgpelskrletaieaieefphgftasghpvg
caialkaidvvmneglaenvrrlaprfeerlkhiaerpnigeyrgigfmwaleavkdkas
ktpfdgnlsvseriantctdlglicrplgqsvvlcppfilteaqmdemfdklekaldkvf
aeva

SCOPe Domain Coordinates for d3nuia1:

Click to download the PDB-style file with coordinates for d3nuia1.
(The format of our PDB-style files is described here.)

Timeline for d3nuia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nuia2