![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Vibrio fluvialis [TaxId:676] [233050] (4 PDB entries) |
![]() | Domain d3nuia1: 3nui A:30-453 [233052] Other proteins in same PDB: d3nuia2, d3nuib2 automated match to d3n5ma_ |
PDB Entry: 3nui (more details), 2 Å
SCOPe Domain Sequences for d3nuia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nuia1 c.67.1.0 (A:30-453) automated matches {Vibrio fluvialis [TaxId: 676]} tvvvthgegpyivdvngrryldansglwnmvagfdhkglidaakaqyerfpgyhaffgrm sdqtvmlseklvevspfdsgrvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwna yhgvtavsasmtgkpynsvfglplpgfvhltcphywrygeegeteeqfvarlareleeti qregadtiagffaepvmgaggvippakgyfqailpilrkydipvisdevicgfgrtgntw gcvtydftpdaiissknltagffpmgavilgpelskrletaieaieefphgftasghpvg caialkaidvvmneglaenvrrlaprfeerlkhiaerpnigeyrgigfmwaleavkdkas ktpfdgnlsvseriantctdlglicrplgqsvvlcppfilteaqmdemfdklekaldkvf aeva
Timeline for d3nuia1: