Lineage for d1cwpa_ (1cwp A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431573Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 2431574Protein Cucumovirus coat protein [88640] (4 species)
  7. 2431615Species Cowpea chlorotic mottle virus [TaxId:12303] [49636] (1 PDB entry)
  8. 2431616Domain d1cwpa_: 1cwp A: [23305]
    protein/RNA complex

Details for d1cwpa_

PDB Entry: 1cwp (more details), 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1cwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwpa_ b.121.4.5 (A:) Cucumovirus coat protein {Cowpea chlorotic mottle virus [TaxId: 12303]}
kaikawtgysvskwtascaaaeakvtsaitislpnelssernkqlkvgrvllwlgllpsv
sgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgitleqlaadltiylyss
aaltegdvivhlevehvrptfddsftpvy

SCOPe Domain Coordinates for d1cwpa_:

Click to download the PDB-style file with coordinates for d1cwpa_.
(The format of our PDB-style files is described here.)

Timeline for d1cwpa_: