Lineage for d3ntvb_ (3ntv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130905Species Staphylococcus aureus [TaxId:196620] [233047] (1 PDB entry)
  8. 2130907Domain d3ntvb_: 3ntv B: [233049]
    automated match to d2gpya_
    complexed with so4

Details for d3ntvb_

PDB Entry: 3ntv (more details), 1.55 Å

PDB Description: Crystal structure of a putative caffeoyl-CoA O-methyltransferase from Staphylococcus aureus
PDB Compounds: (B:) MW1564 protein

SCOPe Domain Sequences for d3ntvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ntvb_ c.66.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
dlnkkylidlhqhqnssievlrefaevnevpivdrltldlikqlirmnnvknileigtai
gyssmqfasisddihvttiernetmiqyakqnlatyhfenqvriiegnaleqfenvndkv
ydmifidaakaqskkffeiytpllkhqglvitdnvlyhgfvsdigivrsrnvrqmvkkvq
dynewlikqpgyttnflniddglaisikg

SCOPe Domain Coordinates for d3ntvb_:

Click to download the PDB-style file with coordinates for d3ntvb_.
(The format of our PDB-style files is described here.)

Timeline for d3ntvb_: