SCOPe 2.08: Domain d3ntva_: 3ntv A:

Lineage for d3ntva_ (3ntv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [233047] (1 PDB entry)

8. Domain d3ntva_: 3ntv A: [233048]
   automated match to d2gpya_
   complexed with so4

Details for d3ntva_

PDB Entry: 3ntv, 1.55 Å

PDB Description: Crystal structure of a putative caffeoyl-CoA O-methyltransferase from Staphylococcus aureus

PDB Compounds: (A:) MW1564 protein

SCOPe Domain Sequences for d3ntva_:

Sequence; same for both SEQRES and ATOM records:

>d3ntva_ c.66.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mddlnkkylidlhqhqnssievlrefaevnevpivdrltldlikqlirmnnvknileigt
aigyssmqfasisddihvttiernetmiqyakqnlatyhfenqvriiegnaleqfenvnd
kvydmifidaakaqskkffeiytpllkhqglvitdnvlyhgfvsdigivrsrnvrqmvkk
vqdynewlikqpgyttnflniddglaisikg

Timeline for d3ntva_:

• d3ntva_ first appeared in SCOPe 2.03
  
• d3ntva_ appears in SCOPe 2.07