Lineage for d3nrzl2 (3nrz L:695-1315)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432242Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1432243Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 1432244Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 1432326Protein automated matches [230468] (2 species)
    not a true protein
  7. 1432327Species Bos taurus [TaxId:9913] [232097] (4 PDB entries)
  8. 1432329Domain d3nrzl2: 3nrz L:695-1315 [233041]
    Other proteins in same PDB: d3nrzc1, d3nrzl1
    automated match to d1v97a5
    complexed with fad, fes, hpa, mos, mte

Details for d3nrzl2

PDB Entry: 3nrz (more details), 1.8 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Hypoxanthine
PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nrzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrzl2 d.133.1.1 (L:695-1315) automated matches {Bos taurus [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkftt

SCOPe Domain Coordinates for d3nrzl2:

Click to download the PDB-style file with coordinates for d3nrzl2.
(The format of our PDB-style files is described here.)

Timeline for d3nrzl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nrzl1