SCOPe 2.08: Domain d3nrzl1: 3nrz L:571-694

Lineage for d3nrzl1 (3nrz L:571-694)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries)

8. Domain d3nrzl1: 3nrz L:571-694 [233040]
   Other proteins in same PDB: d3nrza1, d3nrza2, d3nrzb1, d3nrzb2, d3nrzc2, d3nrzj1, d3nrzj2, d3nrzk1, d3nrzk2, d3nrzl2
   automated match to d1v97a3
   complexed with fad, fes, hpa, mos, mte

Details for d3nrzl1

PDB Entry: 3nrz, 1.8 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Hypoxanthine

PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nrzl1:

Sequence; same for both SEQRES and ATOM records:

>d3nrzl1 d.41.1.0 (L:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3nrzl1:

• d3nrzl1 first appeared in SCOPe 2.03
  
• d3nrzl1 appears in SCOPe 2.07