Lineage for d3nrzc2 (3nrz C:695-1326)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540595Protein automated matches [230468] (3 species)
    not a true protein
  7. 2540596Species Cow (Bos taurus) [TaxId:9913] [232097] (10 PDB entries)
  8. 2540601Domain d3nrzc2: 3nrz C:695-1326 [233039]
    Other proteins in same PDB: d3nrza1, d3nrza2, d3nrzb1, d3nrzb2, d3nrzc1, d3nrzj1, d3nrzj2, d3nrzk1, d3nrzk2, d3nrzl1
    automated match to d1v97a5
    complexed with fad, fes, hpa, mos, mte

Details for d3nrzc2

PDB Entry: 3nrz (more details), 1.8 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Hypoxanthine
PDB Compounds: (C:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nrzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrzc2 d.133.1.1 (C:695-1326) automated matches {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlcvtgapgnck

SCOPe Domain Coordinates for d3nrzc2:

Click to download the PDB-style file with coordinates for d3nrzc2.
(The format of our PDB-style files is described here.)

Timeline for d3nrzc2: