Lineage for d3nrrb2 (3nrr B:205-511)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212579Family d.117.1.0: automated matches [227244] (1 protein)
    not a true family
  6. 2212580Protein automated matches [227010] (5 species)
    not a true protein
  7. 2212588Species Babesia bovis [TaxId:5865] [233034] (1 PDB entry)
  8. 2212590Domain d3nrrb2: 3nrr B:205-511 [233037]
    Other proteins in same PDB: d3nrra1, d3nrrb1
    automated match to d1qzfa2
    complexed with cl, d16, edo, gol, nap, po4, ump

Details for d3nrrb2

PDB Entry: 3nrr (more details), 1.8 Å

PDB Description: co-crystal structure of dihydrofolate reductase-thymidylate synthase from babesia bovis with dump, raltitrexed and nadp
PDB Compounds: (B:) dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3nrrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrrb2 d.117.1.0 (B:205-511) automated matches {Babesia bovis [TaxId: 5865]}
gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd
lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr
eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd
lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg
efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp
ipmamsa

SCOPe Domain Coordinates for d3nrrb2:

Click to download the PDB-style file with coordinates for d3nrrb2.
(The format of our PDB-style files is described here.)

Timeline for d3nrrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nrrb1