Lineage for d3nrrb1 (3nrr B:4-188)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154171Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2154172Protein automated matches [190777] (21 species)
    not a true protein
  7. 2154266Species Babesia bovis [TaxId:5865] [233032] (1 PDB entry)
  8. 2154268Domain d3nrrb1: 3nrr B:4-188 [233036]
    Other proteins in same PDB: d3nrra2, d3nrrb2
    automated match to d2oipa1
    complexed with cl, d16, edo, gol, nap, po4, ump

Details for d3nrrb1

PDB Entry: 3nrr (more details), 1.8 Å

PDB Description: co-crystal structure of dihydrofolate reductase-thymidylate synthase from babesia bovis with dump, raltitrexed and nadp
PDB Compounds: (B:) dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3nrrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrrb1 c.71.1.0 (B:4-188) automated matches {Babesia bovis [TaxId: 5865]}
syegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvv
ifgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifil
ggsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfvi
yerkd

SCOPe Domain Coordinates for d3nrrb1:

Click to download the PDB-style file with coordinates for d3nrrb1.
(The format of our PDB-style files is described here.)

Timeline for d3nrrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nrrb2