SCOPe 2.03: Domain d3nrra1: 3nrr A:3-188

Lineage for d3nrra1 (3nrr A:3-188)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (16 species)
   not a true protein

7. Species Babesia bovis [TaxId:5865] [233032] (1 PDB entry)

8. Domain d3nrra1: 3nrr A:3-188 [233033]
   Other proteins in same PDB: d3nrra2, d3nrrb2
   automated match to d2oipa1
   complexed with cl, d16, edo, gol, nap, po4, ump

Details for d3nrra1

PDB Entry: 3nrr, 1.8 Å

PDB Description: co-crystal structure of dihydrofolate reductase-thymidylate synthase from babesia bovis with dump, raltitrexed and nadp

PDB Compounds: (A:) dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3nrra1:

Sequence; same for both SEQRES and ATOM records:

>d3nrra1 c.71.1.0 (A:3-188) automated matches {Babesia bovis [TaxId: 5865]}
nsyegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnv
vifgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifi
lggsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfv
iyerkd

Timeline for d3nrra1:

• d3nrra1 is new in SCOPe 2.03-stable
  
• d3nrra1 appears in SCOPe 2.04
  
• d3nrra1 appears in the current release, SCOPe 2.08