Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (16 species) not a true protein |
Species Babesia bovis [TaxId:5865] [233032] (1 PDB entry) |
Domain d3nrra1: 3nrr A:3-188 [233033] Other proteins in same PDB: d3nrra2, d3nrrb2 automated match to d2oipa1 complexed with cl, d16, edo, gol, nap, po4, ump |
PDB Entry: 3nrr (more details), 1.8 Å
SCOPe Domain Sequences for d3nrra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nrra1 c.71.1.0 (A:3-188) automated matches {Babesia bovis [TaxId: 5865]} nsyegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnv vifgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifi lggsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfv iyerkd
Timeline for d3nrra1: