Lineage for d2tbvb_ (2tbv B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2076096Family b.121.4.7: Tombusviridae-like VP [88643] (5 protein domains)
  6. 2076130Protein Tombusvirus coat protein [49633] (1 species)
  7. 2076131Species TBSV (Tomato bushy stunt virus) [TaxId:12145] [49634] (1 PDB entry)
  8. 2076133Domain d2tbvb_: 2tbv B: [23303]
    complexed with ca

Details for d2tbvb_

PDB Entry: 2tbv (more details), 2.9 Å

PDB Description: structure of tomato bushy stunt virus. v. coat protein sequence determination and its structural implications
PDB Compounds: (B:) tomato bushy stunt virus

SCOPe Domain Sequences for d2tbvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tbvb_ b.121.4.7 (B:) Tombusvirus coat protein {TBSV (Tomato bushy stunt virus) [TaxId: 12145]}
ggvtvtshreyltqvnnssgfvvnggivgnslqlnpsngtlfswlpalasnfdqysfnsv
vldyvplcgttevgrvalyfdkdsqdpepadrvelanfgvlketapwaeamlriptdkvk
rycndsatvdqklidlgqlgiatyggagadavgelflarsvtlyfpqptntllsskrldl
tgsladatgpgylvltrtptvlthtfratgtfnlsgglrcltsltlgatgavvindilai
dnvgtasdyflnctvsslpatvtftvsgvaagillvgraranvvnll

SCOPe Domain Coordinates for d2tbvb_:

Click to download the PDB-style file with coordinates for d2tbvb_.
(The format of our PDB-style files is described here.)

Timeline for d2tbvb_: