Lineage for d3nf6a_ (3nf6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139404Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2139537Protein automated matches [190209] (5 species)
    not a true protein
  7. 2139538Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (62 PDB entries)
  8. 2139547Domain d3nf6a_: 3nf6 A: [233014]
    automated match to d4ah9a_
    protein/DNA complex; complexed with acy, cl, edo, imv, so4

Details for d3nf6a_

PDB Entry: 3nf6 (more details), 1.9 Å

PDB Description: Structural basis for a new mechanism of inhibition of HIV integrase identified by fragment screening and structure based design
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d3nf6a_:

Sequence, based on SEQRES records: (download)

>d3nf6a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d3nf6a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq

SCOPe Domain Coordinates for d3nf6a_:

Click to download the PDB-style file with coordinates for d3nf6a_.
(The format of our PDB-style files is described here.)

Timeline for d3nf6a_: