Lineage for d3ne1c_ (3ne1 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437357Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1437358Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1437387Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 1437388Protein automated matches [191061] (6 species)
    not a true protein
  7. 1437405Species Mycobacterium tuberculosis [TaxId:1773] [232418] (4 PDB entries)
  8. 1437411Domain d3ne1c_: 3ne1 C: [233009]
    automated match to d3nfdc_
    complexed with so4

Details for d3ne1c_

PDB Entry: 3ne1 (more details), 2.51 Å

PDB Description: mycobacterium tuberculosis acyl carrier protein synthase in complex with sulfate ion
PDB Compounds: (C:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3ne1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ne1c_ d.150.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
givgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaakeavi
kawsgsrfaqrpvlpedihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdta
aavaileap

SCOPe Domain Coordinates for d3ne1c_:

Click to download the PDB-style file with coordinates for d3ne1c_.
(The format of our PDB-style files is described here.)

Timeline for d3ne1c_: