![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
![]() | Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
![]() | Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
![]() | Protein automated matches [191061] (8 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [232418] (5 PDB entries) |
![]() | Domain d3ne1b_: 3ne1 B: [233008] automated match to d3nfdc_ complexed with so4 |
PDB Entry: 3ne1 (more details), 2.51 Å
SCOPe Domain Sequences for d3ne1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ne1b_ d.150.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} givgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaakeavi kawsgsrfaqrpvlpedihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdta aavaileap
Timeline for d3ne1b_: