| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
| Protein automated matches [190159] (12 species) not a true protein |
| Species Escherichia coli [TaxId:544404] [233005] (2 PDB entries) |
| Domain d3ncxb2: 3ncx B:841-934 [233006] Other proteins in same PDB: d3ncxa1, d3ncxb1 automated match to d1f00i3 mutant |
PDB Entry: 3ncx (more details), 2.6 Å
SCOPe Domain Sequences for d3ncxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncxb2 d.169.1.0 (B:841-934) automated matches {Escherichia coli [TaxId: 544404]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqyplpgvnvntpnvyavcve
Timeline for d3ncxb2: