![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein automated matches [190888] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
![]() | Domain d3nccb1: 3ncc B:1-100 [232997] Other proteins in same PDB: d3ncca_ automated match to d3d48r1 complexed with cl, co3, na; mutant |
PDB Entry: 3ncc (more details), 2.5 Å
SCOPe Domain Sequences for d3nccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nccb1 b.1.2.1 (B:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]} mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyi
Timeline for d3nccb1: