Lineage for d3nccb1 (3ncc B:1-100)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762202Domain d3nccb1: 3ncc B:1-100 [232997]
    Other proteins in same PDB: d3ncca_
    automated match to d3d48r1
    complexed with cl, co3, na; mutant

Details for d3nccb1

PDB Entry: 3ncc (more details), 2.5 Å

PDB Description: a human prolactin receptor antagonist in complex with the mutant extracellular domain h188a of the human prolactin receptor
PDB Compounds: (B:) Prolactin receptor

SCOPe Domain Sequences for d3nccb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nccb1 b.1.2.1 (B:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyi

SCOPe Domain Coordinates for d3nccb1:

Click to download the PDB-style file with coordinates for d3nccb1.
(The format of our PDB-style files is described here.)

Timeline for d3nccb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nccb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ncca_