![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries) |
![]() | Domain d3nbpa2: 3nbp A:430-557 [232996] Other proteins in same PDB: d3nbpa1, d3nbpb_ automated match to d3di6a3 complexed with jgz, mn |
PDB Entry: 3nbp (more details), 2.95 Å
SCOPe Domain Sequences for d3nbpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nbpa2 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd klvsagir
Timeline for d3nbpa2: