Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries) |
Domain d3na0c_: 3na0 C: [232993] Other proteins in same PDB: d3na0a_, d3na0b_ automated match to d3n9yc_ complexed with 2dc, fes, hem |
PDB Entry: 3na0 (more details), 2.5 Å
SCOPe Domain Sequences for d3na0c_:
Sequence, based on SEQRES records: (download)
>d3na0c_ d.15.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fgacegtlacstchlifedhiyekldaitdeendmldlaygltdrsrlgcq
>d3na0c_ d.15.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fgacegtlacstctdeendmldlalgcq
Timeline for d3na0c_: