Lineage for d3na0c_ (3na0 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179171Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2179304Protein automated matches [190231] (9 species)
    not a true protein
  7. 2179320Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries)
  8. 2179335Domain d3na0c_: 3na0 C: [232993]
    Other proteins in same PDB: d3na0a_, d3na0b_
    automated match to d3n9yc_
    complexed with 2dc, fes, hem

Details for d3na0c_

PDB Entry: 3na0 (more details), 2.5 Å

PDB Description: crystal structure of human cyp11a1 in complex with 20,22- dihydroxycholesterol
PDB Compounds: (C:) Adrenodoxin, mitochondrial

SCOPe Domain Sequences for d3na0c_:

Sequence, based on SEQRES records: (download)

>d3na0c_ d.15.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fgacegtlacstchlifedhiyekldaitdeendmldlaygltdrsrlgcq

Sequence, based on observed residues (ATOM records): (download)

>d3na0c_ d.15.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fgacegtlacstctdeendmldlalgcq

SCOPe Domain Coordinates for d3na0c_:

Click to download the PDB-style file with coordinates for d3na0c_.
(The format of our PDB-style files is described here.)

Timeline for d3na0c_: