SCOPe 2.08: Domain d3na0c_: 3na0 C:

Lineage for d3na0c_ (3na0 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries)

8. Domain d3na0c_: 3na0 C: [232993]
   Other proteins in same PDB: d3na0a_, d3na0b_
   automated match to d3n9yc_
   complexed with 2dc, fes, hem
   fragment; missing more than one-third of the common structure and/or sequence

Details for d3na0c_

PDB Entry: 3na0, 2.5 Å

PDB Description: crystal structure of human cyp11a1 in complex with 20,22- dihydroxycholesterol

PDB Compounds: (C:) Adrenodoxin, mitochondrial

SCOPe Domain Sequences for d3na0c_:

Sequence, based on SEQRES records:

>d3na0c_ d.15.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fgacegtlacstchlifedhiyekldaitdeendmldlaygltdrsrlgcq

Sequence, based on observed residues (ATOM records):

>d3na0c_ d.15.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fgacegtlacstctdeendmldlalgcq

Timeline for d3na0c_:

• d3na0c_ first appeared in SCOPe 2.03
  
• d3na0c_ appears in SCOPe 2.07