![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
![]() | Protein automated matches [190445] (6 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries) |
![]() | Domain d3n7ka2: 3n7k A:1094-1290 [232992] Other proteins in same PDB: d3n7ka1, d3n7kb1 automated match to d3btaa2 |
PDB Entry: 3n7k (more details), 2.5 Å
SCOPe Domain Sequences for d3n7ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n7ka2 b.42.4.0 (A:1094-1290) automated matches {Clostridium botulinum [TaxId: 1491]} ytnvvkdywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikri rgntndtrvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindn iifqiqpmnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgny aslleststhwgfvpvs
Timeline for d3n7ka2: