Lineage for d3n7kb2 (3n7k B:1094-1290)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062372Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2062399Domain d3n7kb2: 3n7k B:1094-1290 [232991]
    Other proteins in same PDB: d3n7ka1, d3n7kb1
    automated match to d3btaa2

Details for d3n7kb2

PDB Entry: 3n7k (more details), 2.5 Å

PDB Description: crystal structure of botulinum neurotoxin serotype c1 binding domain
PDB Compounds: (B:) Botulinum neurotoxin type C1

SCOPe Domain Sequences for d3n7kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n7kb2 b.42.4.0 (B:1094-1290) automated matches {Clostridium botulinum [TaxId: 1491]}
ytnvvkdywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikri
rgntndtrvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindn
iifqiqpmnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgny
aslleststhwgfvpvs

SCOPe Domain Coordinates for d3n7kb2:

Click to download the PDB-style file with coordinates for d3n7kb2.
(The format of our PDB-style files is described here.)

Timeline for d3n7kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n7kb1