Lineage for d3n6jd2 (3n6j D:139-447)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099419Species Actinobacillus succinogenes [TaxId:339671] [232973] (3 PDB entries)
  8. 2099431Domain d3n6jd2: 3n6j D:139-447 [232988]
    Other proteins in same PDB: d3n6ja1, d3n6jb1, d3n6jb3, d3n6jc1, d3n6jd1
    automated match to d4g8ta2

Details for d3n6jd2

PDB Entry: 3n6j (more details), 2.4 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6jd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n6jd2 c.1.11.0 (D:139-447) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
pgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskd
rygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvlt
yaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfw
tltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfy
ltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkf
drkrpamvr

SCOPe Domain Coordinates for d3n6jd2:

Click to download the PDB-style file with coordinates for d3n6jd2.
(The format of our PDB-style files is described here.)

Timeline for d3n6jd2: