| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Actinobacillus succinogenes [TaxId:339671] [232973] (3 PDB entries) |
| Domain d3n6jd2: 3n6j D:139-447 [232988] Other proteins in same PDB: d3n6ja1, d3n6jb1, d3n6jb3, d3n6jc1, d3n6jd1 automated match to d4g8ta2 |
PDB Entry: 3n6j (more details), 2.4 Å
SCOPe Domain Sequences for d3n6jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n6jd2 c.1.11.0 (D:139-447) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
pgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskd
rygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvlt
yaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfw
tltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfy
ltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkf
drkrpamvr
Timeline for d3n6jd2: