SCOPe 2.03: Domain d3n6jb1: 3n6j B:6-138

Lineage for d3n6jb1 (3n6j B:6-138)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [225929] (3 PDB entries)

8. Domain d3n6jb1: 3n6j B:6-138 [232982]
   Other proteins in same PDB: d3n6ja2, d3n6jb2, d3n6jc2, d3n6jd2
   automated match to d4g8ta1

Details for d3n6jb1

PDB Entry: 3n6j, 2.4 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6jb1:

Sequence, based on SEQRES records:

>d3n6jb1 d.54.1.0 (B:6-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
lteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlm
gqflgvpvaellg

Sequence, based on observed residues (ATOM records):

>d3n6jb1 d.54.1.0 (B:6-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
lteaiphvvgrpisilnkivndmhngywtfelrvnavaaleaalldlmgqflgvpvaell
g

Timeline for d3n6jb1:

• d3n6jb1 is new in SCOPe 2.03-stable
  
• d3n6jb1 appears in SCOPe 2.04
  
• d3n6jb1 appears in the current release, SCOPe 2.08