Lineage for d3n6jb1 (3n6j B:6-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947883Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)
  8. 2947897Domain d3n6jb1: 3n6j B:6-138 [232982]
    Other proteins in same PDB: d3n6ja2, d3n6jb2, d3n6jb3, d3n6jc2, d3n6jd2
    automated match to d4g8ta1

Details for d3n6jb1

PDB Entry: 3n6j (more details), 2.4 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6jb1:

Sequence, based on SEQRES records: (download)

>d3n6jb1 d.54.1.0 (B:6-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
lteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlm
gqflgvpvaellg

Sequence, based on observed residues (ATOM records): (download)

>d3n6jb1 d.54.1.0 (B:6-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
lteaiphvvgrpisilnkivndmhngywtfelrvnavaaleaalldlmgqflgvpvaell
g

SCOPe Domain Coordinates for d3n6jb1:

Click to download the PDB-style file with coordinates for d3n6jb1.
(The format of our PDB-style files is described here.)

Timeline for d3n6jb1: