![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (55 species) not a true protein |
![]() | Species Actinobacillus succinogenes [TaxId:339671] [225929] (3 PDB entries) |
![]() | Domain d3n6hc1: 3n6h C:7-138 [232977] Other proteins in same PDB: d3n6ha2, d3n6hb2, d3n6hc2, d3n6hd2 automated match to d4g8ta1 complexed with cl, mg, so4 |
PDB Entry: 3n6h (more details), 2.3 Å
SCOPe Domain Sequences for d3n6hc1:
Sequence, based on SEQRES records: (download)
>d3n6hc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]} svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal teaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmg qflgvpvaellg
>d3n6hc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]} svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellg
Timeline for d3n6hc1: