Lineage for d3n6hc1 (3n6h C:7-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947883Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)
  8. 2947894Domain d3n6hc1: 3n6h C:7-138 [232977]
    Other proteins in same PDB: d3n6ha2, d3n6ha3, d3n6hb2, d3n6hb3, d3n6hc2, d3n6hd2, d3n6hd3
    automated match to d4g8ta1
    complexed with cl, mg, so4

Details for d3n6hc1

PDB Entry: 3n6h (more details), 2.3 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6hc1:

Sequence, based on SEQRES records: (download)

>d3n6hc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmg
qflgvpvaellg

Sequence, based on observed residues (ATOM records): (download)

>d3n6hc1 d.54.1.0 (C:7-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellg

SCOPe Domain Coordinates for d3n6hc1:

Click to download the PDB-style file with coordinates for d3n6hc1.
(The format of our PDB-style files is described here.)

Timeline for d3n6hc1: