Lineage for d3n6ha2 (3n6h A:139-447)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837254Species Actinobacillus succinogenes [TaxId:339671] [232973] (3 PDB entries)
  8. 2837259Domain d3n6ha2: 3n6h A:139-447 [232974]
    Other proteins in same PDB: d3n6ha1, d3n6ha3, d3n6hb1, d3n6hb3, d3n6hc1, d3n6hd1, d3n6hd3
    automated match to d4g8ta2
    complexed with cl, mg, so4

Details for d3n6ha2

PDB Entry: 3n6h (more details), 2.3 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n6ha2 c.1.11.0 (A:139-447) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
pgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskd
rygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvlt
yaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfw
tltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfy
ltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkf
drkrpamvr

SCOPe Domain Coordinates for d3n6ha2:

Click to download the PDB-style file with coordinates for d3n6ha2.
(The format of our PDB-style files is described here.)

Timeline for d3n6ha2: