SCOPe 2.08: Domain d3n06b1: 3n06 B:1-100

Lineage for d3n06b1 (3n06 B:1-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d3n06b1: 3n06 B:1-100 [232971]
   Other proteins in same PDB: d3n06a_
   automated match to d3d48r1
   complexed with cl, na; mutant

Details for d3n06b1

PDB Entry: 3n06, 2 Å

PDB Description: a mutant human prolactin receptor antagonist h27a in complex with the extracellular domain of the human prolactin receptor

PDB Compounds: (B:) Prolactin receptor

SCOPe Domain Sequences for d3n06b1:

Sequence; same for both SEQRES and ATOM records:

>d3n06b1 b.1.2.1 (B:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyi

Timeline for d3n06b1:

• d3n06b1 first appeared in SCOPe 2.03
  
• d3n06b1 appears in SCOPe 2.07