Lineage for d3mzna2 (3mzn A:133-440)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837422Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)
  8. 2837448Domain d3mzna2: 3mzn A:133-440 [232970]
    Other proteins in same PDB: d3mzna1, d3mzna3, d3mzna4, d3mznb1, d3mznb3, d3mznb4
    automated match to d4g8ta2
    complexed with act, gol, so4

Details for d3mzna2

PDB Entry: 3mzn (more details), 1.85 Å

PDB Description: crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3mzna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzna2 c.1.11.0 (A:133-440) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
qygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamtpeavanlaraay
drygfkdfklkggvlrgeeeadciralheafpearlaldpngawkldeavrvlepikhll
syaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavqlnsvdipladchf
wtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeitaidthwiwqdgqr
itrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrndamamqylipgwef
dpkrpalv

SCOPe Domain Coordinates for d3mzna2:

Click to download the PDB-style file with coordinates for d3mzna2.
(The format of our PDB-style files is described here.)

Timeline for d3mzna2: