SCOPe 2.06: Domain d1a6ca2: 1a6c A:177-348

Lineage for d1a6ca2 (1a6c A:177-348)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
   duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains

6. Protein Nepovirus capsid protein [49629] (1 species)
   duplication: cnosists of three very similar domains

7. Species TRSV (Tobacco ringspot virus) [TaxId:12282] [49630] (1 PDB entry)

8. Domain d1a6ca2: 1a6c A:177-348 [23297]

Details for d1a6ca2

PDB Entry: 1a6c, 3.5 Å

PDB Description: structure of tobacco ringspot virus

PDB Compounds: (A:) tobacco ringspot virus capsid protein

SCOPe Domain Sequences for d1a6ca2:

Sequence; same for both SEQRES and ATOM records:

>d1a6ca2 b.121.4.2 (A:177-348) Nepovirus capsid protein {TRSV (Tobacco ringspot virus) [TaxId: 12282]}
ptmtwpiqlgdtfaidryyeakeikldgstsmlsisynfggpvkhskkhaisysravmsr
nlgwsgtisgsvksvsslfctasfvifpweceapptlrqvlwgphqimhgdgqfeiaikt
rlhsaatteegfgrlgilplsgpiapdahvgsyefivhintwrpdsqvhppm

Timeline for d1a6ca2:

• d1a6ca2 first appeared (with stable ids) in SCOP 1.55
  
• d1a6ca2 appears in SCOPe 2.05
  
• d1a6ca2 appears in SCOPe 2.07
  
• d1a6ca2 appears in the current release, SCOPe 2.08