Lineage for d3mzna1 (3mzn A:2-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948105Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)
  8. 2948131Domain d3mzna1: 3mzn A:2-132 [232969]
    Other proteins in same PDB: d3mzna2, d3mzna3, d3mzna4, d3mznb2, d3mznb3, d3mznb4
    automated match to d4g8ta1
    complexed with act, gol, so4

Details for d3mzna1

PDB Entry: 3mzn (more details), 1.85 Å

PDB Description: crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3mzna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzna1 d.54.1.0 (A:2-132) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
fpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngle
kcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfgq
algmpvadllg

SCOPe Domain Coordinates for d3mzna1:

Click to download the PDB-style file with coordinates for d3mzna1.
(The format of our PDB-style files is described here.)

Timeline for d3mzna1: