Lineage for d3mzhb2 (3mzh B:145-224)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308331Species Mycobacterium tuberculosis [TaxId:83332] [232395] (4 PDB entries)
  8. 2308335Domain d3mzhb2: 3mzh B:145-224 [232965]
    Other proteins in same PDB: d3mzha1, d3mzha3, d3mzhb1, d3mzhb3
    automated match to d3r6sd2
    protein/DNA complex; complexed with cmp

Details for d3mzhb2

PDB Entry: 3mzh (more details), 2.9 Å

PDB Description: Crystal structure of cAMP receptor protein from mycobacterium tuberculosis in complex with cAMP and its DNA binding element
PDB Compounds: (B:) probable transcriptional regulatory protein (probably crp/fnr-family)

SCOPe Domain Sequences for d3mzhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzhb2 a.4.5.0 (B:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarrar

SCOPe Domain Coordinates for d3mzhb2:

Click to download the PDB-style file with coordinates for d3mzhb2.
(The format of our PDB-style files is described here.)

Timeline for d3mzhb2: