SCOPe 2.03: Domain d3mzhb2: 3mzh B:145-224

Lineage for d3mzhb2 (3mzh B:145-224)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [232395] (2 PDB entries)

8. Domain d3mzhb2: 3mzh B:145-224 [232965]
   Other proteins in same PDB: d3mzha1, d3mzhb1
   automated match to d3r6sd2
   protein/DNA complex; complexed with cmp

Details for d3mzhb2

PDB Entry: 3mzh, 2.9 Å

PDB Description: Crystal structure of cAMP receptor protein from mycobacterium tuberculosis in complex with cAMP and its DNA binding element

PDB Compounds: (B:) probable transcriptional regulatory protein (probably crp/fnr-family)

SCOPe Domain Sequences for d3mzhb2:

Sequence; same for both SEQRES and ATOM records:

>d3mzhb2 a.4.5.0 (B:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarrar

Timeline for d3mzhb2:

• d3mzhb2 is new in SCOPe 2.03-stable
  
• d3mzhb2 appears in SCOPe 2.04
  
• d3mzhb2 appears in the current release, SCOPe 2.08