Lineage for d3mzha2 (3mzh A:145-224)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480151Species Mycobacterium tuberculosis [TaxId:83332] [232395] (3 PDB entries)
  8. 1480154Domain d3mzha2: 3mzh A:145-224 [232964]
    Other proteins in same PDB: d3mzha1, d3mzhb1
    automated match to d3r6sd2
    protein/DNA complex; complexed with cmp

Details for d3mzha2

PDB Entry: 3mzh (more details), 2.9 Å

PDB Description: Crystal structure of cAMP receptor protein from mycobacterium tuberculosis in complex with cAMP and its DNA binding element
PDB Compounds: (A:) probable transcriptional regulatory protein (probably crp/fnr-family)

SCOPe Domain Sequences for d3mzha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzha2 a.4.5.0 (A:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarrar

SCOPe Domain Coordinates for d3mzha2:

Click to download the PDB-style file with coordinates for d3mzha2.
(The format of our PDB-style files is described here.)

Timeline for d3mzha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mzha1