| Class b: All beta proteins [48724] (178 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
| Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
| Protein automated matches [226927] (18 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [232366] (2 PDB entries) |
| Domain d3mzha1: 3mzh A:1-144 [232961] Other proteins in same PDB: d3mzha2, d3mzha3, d3mzhb2, d3mzhb3 automated match to d3r6sf1 protein/DNA complex; complexed with cmp |
PDB Entry: 3mzh (more details), 2.9 Å
SCOPe Domain Sequences for d3mzha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mzha1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
eqllrvlarrlrrtnnnladlift
Timeline for d3mzha1: