Lineage for d3mzha1 (3mzh A:1-144)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426259Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2426260Protein automated matches [226927] (18 species)
    not a true protein
  7. 2426343Species Mycobacterium tuberculosis [TaxId:83332] [232366] (2 PDB entries)
  8. 2426346Domain d3mzha1: 3mzh A:1-144 [232961]
    Other proteins in same PDB: d3mzha2, d3mzha3, d3mzhb2, d3mzhb3
    automated match to d3r6sf1
    protein/DNA complex; complexed with cmp

Details for d3mzha1

PDB Entry: 3mzh (more details), 2.9 Å

PDB Description: Crystal structure of cAMP receptor protein from mycobacterium tuberculosis in complex with cAMP and its DNA binding element
PDB Compounds: (A:) probable transcriptional regulatory protein (probably crp/fnr-family)

SCOPe Domain Sequences for d3mzha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzha1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
eqllrvlarrlrrtnnnladlift

SCOPe Domain Coordinates for d3mzha1:

Click to download the PDB-style file with coordinates for d3mzha1.
(The format of our PDB-style files is described here.)

Timeline for d3mzha1: