SCOPe 2.03: Domain d3mzhb1: 3mzh B:0-144

Lineage for d3mzhb1 (3mzh B:0-144)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [232366] (2 PDB entries)

8. Domain d3mzhb1: 3mzh B:0-144 [232960]
   Other proteins in same PDB: d3mzha2, d3mzhb2
   automated match to d3r6sf1
   protein/DNA complex; complexed with cmp

Details for d3mzhb1

PDB Entry: 3mzh, 2.9 Å

PDB Description: Crystal structure of cAMP receptor protein from mycobacterium tuberculosis in complex with cAMP and its DNA binding element

PDB Compounds: (B:) probable transcriptional regulatory protein (probably crp/fnr-family)

SCOPe Domain Sequences for d3mzhb1:

Sequence; same for both SEQRES and ATOM records:

>d3mzhb1 b.82.3.0 (B:0-144) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigr
rapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpei
seqllrvlarrlrrtnnnladlift

Timeline for d3mzhb1:

• d3mzhb1 is new in SCOPe 2.03-stable
  
• d3mzhb1 appears in SCOPe 2.04
  
• d3mzhb1 appears in the current release, SCOPe 2.08