SCOP 1.59: Domain d1a6ca1: 1a6c A:1-176

Lineage for d1a6ca1 (1a6c A:1-176)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (15 proteins)

6. Protein TRSV capsid protein [49629] (1 species)

7. Species Tobacco ringspot virus [TaxId:12282] [49630] (1 PDB entry)

8. Domain d1a6ca1: 1a6c A:1-176 [23296]

Details for d1a6ca1

PDB Entry: 1a6c, 3.5 Å

PDB Description: structure of tobacco ringspot virus

SCOP Domain Sequences for d1a6ca1:

Sequence; same for both SEQRES and ATOM records:

>d1a6ca1 b.10.1.2 (A:1-176) TRSV capsid protein {Tobacco ringspot virus}
avtvvpdptccgtlsfkvpkdakkgkhlgtfdirqaimdygglhsqewcakgivnptftv
rmhaprnafaglsiactfddykridlpalgnecppsemfelptkvfmlkdadvhewqfny
geltghglcnwanvatqptlyffvastnqvtmaadwqcivtmhvdmgpvidrfeln

Timeline for d1a6ca1:

• d1a6ca1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6ca1 appears in SCOP 1.57
  
• d1a6ca1 appears in SCOP 1.61
  
• d1a6ca1 appears in the current release, SCOPe 2.08