Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins) duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains |
Protein Nepovirus capsid protein [49629] (1 species) duplication: cnosists of three very similar domains |
Species TRSV (Tobacco ringspot virus) [TaxId:12282] [49630] (1 PDB entry) |
Domain d1a6ca1: 1a6c A:1-176 [23296] |
PDB Entry: 1a6c (more details), 3.5 Å
SCOPe Domain Sequences for d1a6ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6ca1 b.121.4.2 (A:1-176) Nepovirus capsid protein {TRSV (Tobacco ringspot virus) [TaxId: 12282]} avtvvpdptccgtlsfkvpkdakkgkhlgtfdirqaimdygglhsqewcakgivnptftv rmhaprnafaglsiactfddykridlpalgnecppsemfelptkvfmlkdadvhewqfny geltghglcnwanvatqptlyffvastnqvtmaadwqcivtmhvdmgpvidrfeln
Timeline for d1a6ca1: