Lineage for d1a6ca1 (1a6c A:1-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822235Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
    duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains
  6. 2822254Protein Nepovirus capsid protein [49629] (1 species)
    duplication: cnosists of three very similar domains
  7. 2822255Species TRSV (Tobacco ringspot virus) [TaxId:12282] [49630] (1 PDB entry)
  8. 2822256Domain d1a6ca1: 1a6c A:1-176 [23296]

Details for d1a6ca1

PDB Entry: 1a6c (more details), 3.5 Å

PDB Description: structure of tobacco ringspot virus
PDB Compounds: (A:) tobacco ringspot virus capsid protein

SCOPe Domain Sequences for d1a6ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6ca1 b.121.4.2 (A:1-176) Nepovirus capsid protein {TRSV (Tobacco ringspot virus) [TaxId: 12282]}
avtvvpdptccgtlsfkvpkdakkgkhlgtfdirqaimdygglhsqewcakgivnptftv
rmhaprnafaglsiactfddykridlpalgnecppsemfelptkvfmlkdadvhewqfny
geltghglcnwanvatqptlyffvastnqvtmaadwqcivtmhvdmgpvidrfeln

SCOPe Domain Coordinates for d1a6ca1:

Click to download the PDB-style file with coordinates for d1a6ca1.
(The format of our PDB-style files is described here.)

Timeline for d1a6ca1: