![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
![]() | Protein automated matches [190763] (13 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:263] [232950] (1 PDB entry) |
![]() | Domain d3msub1: 3msu B:1-424 [232952] Other proteins in same PDB: d3msua2, d3msub2 automated match to d4e6ya_ complexed with acy, cl, oaa, so4, trs, zn |
PDB Entry: 3msu (more details), 1.84 Å
SCOPe Domain Sequences for d3msub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3msub1 a.103.1.0 (B:1-424) automated matches {Francisella tularensis [TaxId: 263]} mevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaaces kityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkmpvc ehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaamayr hnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnaststv rlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdkddpf rlmgfghrvykntdpratamkknceeilaklghsdnplltvakkleeialqdeffierkl fsnvdfysgiilkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlytgat nrnf
Timeline for d3msub1: