Lineage for d3msua1 (3msu A:1-424)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004906Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 2004907Protein automated matches [190763] (6 species)
    not a true protein
  7. 2004911Species Francisella tularensis [TaxId:263] [232950] (1 PDB entry)
  8. 2004912Domain d3msua1: 3msu A:1-424 [232951]
    Other proteins in same PDB: d3msua2, d3msub2
    automated match to d4e6ya_
    complexed with acy, cl, oaa, so4, trs, zn

Details for d3msua1

PDB Entry: 3msu (more details), 1.84 Å

PDB Description: Crystal Structure of Citrate Synthase from Francisella tularensis
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d3msua1:

Sequence, based on SEQRES records: (download)

>d3msua1 a.103.1.0 (A:1-424) automated matches {Francisella tularensis [TaxId: 263]}
mevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaaces
kityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkmpvc
ehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaamayr
hnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnaststv
rlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdkddpf
rlmgfghrvykntdpratamkknceeilaklghsdnplltvakkleeialqdeffierkl
fsnvdfysgiilkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlytgat
nrnf

Sequence, based on observed residues (ATOM records): (download)

>d3msua1 a.103.1.0 (A:1-424) automated matches {Francisella tularensis [TaxId: 263]}
mevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaaces
kityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkmpvc
ehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaamayr
hnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnaststv
rlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdklmgf
ghrvykntdpratamkknceeilaklghsdnplltvakkleeialerklfsnvdfysgii
lkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlytgatnrnf

SCOPe Domain Coordinates for d3msua1:

Click to download the PDB-style file with coordinates for d3msua1.
(The format of our PDB-style files is described here.)

Timeline for d3msua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3msua2