SCOPe 2.07: Domain d3mqmb1: 3mqm B:2433-2556

Lineage for d3mqmb1 (3mqm B:2433-2556)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d3mqmb1: 3mqm B:2433-2556 [232949]
   Other proteins in same PDB: d3mqma2, d3mqmb2
   automated match to d3ljwb_

Details for d3mqmb1

PDB Entry: 3mqm, 2.54 Å

PDB Description: Crystal Structure of the Bromodomain of human ASH1L

PDB Compounds: (B:) Probable histone-lysine N-methyltransferase ASH1L

SCOPe Domain Sequences for d3mqmb1:

Sequence; same for both SEQRES and ATOM records:

>d3mqmb1 a.29.2.0 (B:2433-2556) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evaraarlaqifkeicdgiisykdssrqalaapllnlppkkknadyyekisdpldlitie
kqiltgyyktveafdadmlkvfrnaekyygrkspvgrdvcrlrkayynarheasaqidei
vget

Timeline for d3mqmb1:

• d3mqmb1 first appeared in SCOPe 2.03, called d3mqmb_
  
• d3mqmb1 appears in SCOPe 2.06
  
• d3mqmb1 appears in the current release, SCOPe 2.08