Lineage for d3mppg1 (3mpp G:867-1087)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781886Species Clostridium botulinum [TaxId:1491] [225675] (21 PDB entries)
  8. 1781892Domain d3mppg1: 3mpp G:867-1087 [232938]
    Other proteins in same PDB: d3mppg2
    automated match to d3btaa1

Details for d3mppg1

PDB Entry: 3mpp (more details), 1.98 Å

PDB Description: Botulinum Neurotoxin Type G Receptor Binding Domain
PDB Compounds: (G:) botulinum neurotoxin type g

SCOPe Domain Sequences for d3mppg1:

Sequence, based on SEQRES records: (download)

>d3mppg1 b.29.1.0 (G:867-1087) automated matches {Clostridium botulinum [TaxId: 1491]}
snailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqskfvvy
dsmfdnfsinfwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvn
aksksiffeysikdnisdyinkwfsititndrlgnaniyingslkksekilnldrinssn
didfklinctdttkfvwikdfnifgrelnateveerykiqs

Sequence, based on observed residues (ATOM records): (download)

>d3mppg1 b.29.1.0 (G:867-1087) automated matches {Clostridium botulinum [TaxId: 1491]}
snailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqdnfsin
fwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvnaksksiffey
sikdnisdyinkwfsititndrlgnaniyingslkksekildrinssndidfklinctdt
tkfvwikdfnifgrelnateveerykiqs

SCOPe Domain Coordinates for d3mppg1:

Click to download the PDB-style file with coordinates for d3mppg1.
(The format of our PDB-style files is described here.)

Timeline for d3mppg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mppg2