Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Streptomyces avermitilis [TaxId:227882] [232929] (1 PDB entry) |
Domain d3mmzc1: 3mmz C:4-164 [232932] Other proteins in same PDB: d3mmza2, d3mmzb2, d3mmzc2, d3mmzd2, d3mmzd3 automated match to d3e81a_ complexed with ca, cl |
PDB Entry: 3mmz (more details), 1.84 Å
SCOPe Domain Sequences for d3mmzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmzc1 c.108.1.0 (C:4-164) automated matches {Streptomyces avermitilis [TaxId: 227882]} galptaedidavvldfdgtqtddrvlidsdgrefvsvhrgdglgiaalrksgltmlilst eqnpvvaararklkipvlhgidrkdlalkqwceeqgiapervlyvgndvndlpcfalvgw pvavasahdvvrgaaravttvpggdgaireiaswilgpsld
Timeline for d3mmzc1: