SCOPe 2.08: Domain d3mmzc1: 3mmz C:4-164

Lineage for d3mmzc1 (3mmz C:4-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Streptomyces avermitilis [TaxId:227882] [232929] (1 PDB entry)

8. Domain d3mmzc1: 3mmz C:4-164 [232932]
   Other proteins in same PDB: d3mmza2, d3mmzb2, d3mmzc2, d3mmzd2, d3mmzd3
   automated match to d3e81a_
   complexed with ca, cl

Details for d3mmzc1

PDB Entry: 3mmz, 1.84 Å

PDB Description: crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680

PDB Compounds: (C:) putative HAD family hydrolase

SCOPe Domain Sequences for d3mmzc1:

Sequence; same for both SEQRES and ATOM records:

>d3mmzc1 c.108.1.0 (C:4-164) automated matches {Streptomyces avermitilis [TaxId: 227882]}
galptaedidavvldfdgtqtddrvlidsdgrefvsvhrgdglgiaalrksgltmlilst
eqnpvvaararklkipvlhgidrkdlalkqwceeqgiapervlyvgndvndlpcfalvgw
pvavasahdvvrgaaravttvpggdgaireiaswilgpsld

Timeline for d3mmzc1:

• d3mmzc1 first appeared in SCOPe 2.03, called d3mmzc_
  
• d3mmzc1 appears in SCOPe 2.07