Lineage for d3mmzc1 (3mmz C:4-164)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (52 species)
    not a true protein
  7. 2491889Species Streptomyces avermitilis [TaxId:227882] [232929] (1 PDB entry)
  8. 2491892Domain d3mmzc1: 3mmz C:4-164 [232932]
    Other proteins in same PDB: d3mmza2, d3mmzb2, d3mmzc2, d3mmzd2, d3mmzd3
    automated match to d3e81a_
    complexed with ca, cl

Details for d3mmzc1

PDB Entry: 3mmz (more details), 1.84 Å

PDB Description: crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680
PDB Compounds: (C:) putative HAD family hydrolase

SCOPe Domain Sequences for d3mmzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmzc1 c.108.1.0 (C:4-164) automated matches {Streptomyces avermitilis [TaxId: 227882]}
galptaedidavvldfdgtqtddrvlidsdgrefvsvhrgdglgiaalrksgltmlilst
eqnpvvaararklkipvlhgidrkdlalkqwceeqgiapervlyvgndvndlpcfalvgw
pvavasahdvvrgaaravttvpggdgaireiaswilgpsld

SCOPe Domain Coordinates for d3mmzc1:

Click to download the PDB-style file with coordinates for d3mmzc1.
(The format of our PDB-style files is described here.)

Timeline for d3mmzc1: