Lineage for d3mmzb1 (3mmz B:4-164)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920661Species Streptomyces avermitilis [TaxId:227882] [232929] (1 PDB entry)
  8. 2920663Domain d3mmzb1: 3mmz B:4-164 [232931]
    Other proteins in same PDB: d3mmza2, d3mmzb2, d3mmzc2, d3mmzd2, d3mmzd3
    automated match to d3e81a_
    complexed with ca, cl

Details for d3mmzb1

PDB Entry: 3mmz (more details), 1.84 Å

PDB Description: crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680
PDB Compounds: (B:) putative HAD family hydrolase

SCOPe Domain Sequences for d3mmzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmzb1 c.108.1.0 (B:4-164) automated matches {Streptomyces avermitilis [TaxId: 227882]}
galptaedidavvldfdgtqtddrvlidsdgrefvsvhrgdglgiaalrksgltmlilst
eqnpvvaararklkipvlhgidrkdlalkqwceeqgiapervlyvgndvndlpcfalvgw
pvavasahdvvrgaaravttvpggdgaireiaswilgpsld

SCOPe Domain Coordinates for d3mmzb1:

Click to download the PDB-style file with coordinates for d3mmzb1.
(The format of our PDB-style files is described here.)

Timeline for d3mmzb1: